Your Position: Home > Recombinant Proteins > N-terminal GST-tagged

N-terminal GST-tagged

AP76500
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP76500 1mg $219.00

Quantity:  Total:   
 

Availability: promotion

add promotion
Description
  • Product Name N-terminal GST-tagged
  • Species Reactivity Hu
  • Specificity E.coli
  • Target Name GST-Tag
  • Calculated MW 27 Kda
  • Tag Info N-terminal GST-tagged
  • Target Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
  • Concentration 0.1-5 mg/ml, by the Bradford Method.
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Application Details

 Greater than 85% as determined by SDS-PAGE.

Images
  • N-terminal GST-tagged - SAB | Signalway Antibody


Background

 GST (Glutathione S-Transferase) is a 26kDa protein which was widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

    Please let us know if you have published research using #AP76500 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com