Your Position: Home > Recombinant Proteins > Recombinant Human Cancer,testis antigen 2(CTAG2)

Recombinant Human Cancer,testis antigen 2(CTAG2)

AP77850
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP77850-1 10ug $277.00
AP77850-2 50ug $395.00
AP77850-3 100ug $683.00
AP77850-4 200ug $1124.00
AP77850-5 500ug $1586.00
AP77850-6 1mg $2523.00

Quantity:  Total:   
 

Availability: promotion27-37 business day

add promotion
Description
  • Product Name Recombinant Human Cancer,testis antigen 2(CTAG2)
  • Brief Description Recombinant Protein
  • Host Species Yeast
  • Purification Greater than 85% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:1-210aa
    Sequence Info:Full Length
  • Alternative Names Autoimmunogenic cancer,testis antigen NY-ESO-2 Cancer,testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1
  • Accession No. O75638
  • Calculated MW 34kDa
  • Tag Info N-terminal 6xHis-sumostar-tagged
  • Target Sequence MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Background

0

Regerences

"CD4+ Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame." Slager E.H., Borghi M., van der Minne C.E., Aarnoudse C.A., Havenga M.J., Schrier P.I., Osanto S., Griffioen M. J. Immunol. 170:1490-1497(2003)
Research Topic:Others

    Please let us know if you have published research using #AP77850 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2019 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com