Your Position: Home > Recombinant Proteins > Recombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)

Recombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)

AP74446
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP74446 500ug $1101.00

Quantity:  Total:   
 

Availability: promotion15-25 business day

add promotion
Description
  • Product Name Recombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)
  • Host Species E.coli
  • Immunogen Description Greater than 85% as determined by SDS-PAGE.
  • Target Name mscL
  • Accession No. Uniprot ID: P0A743
  • Target Species Escherichia coli O157:H7
  • Calculated MW 30.95kDa
  • Target Length Full Length,1-136aa
  • Tag Info N-terminal 6xHis-B2M-tagged
  • Target Sequence MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Background

Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity).

Regerences

 "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12."Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T.  Shinagawa H.DNA Res. 8:11-22(2001)

    Please let us know if you have published research using #AP74446 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2019 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com