Your Position: Home > Recombinant Proteins > Recombinant Human Thymic stromal lymphopoietin(TSLP)

Recombinant Human Thymic stromal lymphopoietin(TSLP)

AP74676
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP74676 20ug $469.00

Quantity:  Total:   
 

Availability: promotionYes

add promotion
Description
  • Product Name Recombinant Human Thymic stromal lymphopoietin(TSLP)
  • Brief Description Recombinant Human Thymic stromal lymphopoietin(TSLP)
  • Host Species Mammalian Cell
  • Target Name TSLP
  • Accession No. Uniprot ID: Q969D9
  • Target Species Hu
  • SDS-PAGE MW 18.51kDa
  • Target Length Full Length,29-159aa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Application Details

 Greater than 90% as determined by SDS-PAGE.

Background

 Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.
Regerences

 "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)

    Please let us know if you have published research using #AP74676 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2019 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com