Your Position: Home > Recombinant Proteins > Recombinant Human Collagen alpha-3(IV) chain(COL4A3),partial

Recombinant Human Collagen alpha-3(IV) chain(COL4A3),partial

AP70182
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP70182-1 10ug $130.00
AP70182-2 50ug $186.00
AP70182-3 100ug $323.00
AP70182-4 200ug $532.00
AP70182-5 500ug $895.00
AP70182-6 1mg $1428.00

Quantity:  Total:   
 

Availability: promotion15-25 business day

add promotion
Description
  • Product Name Recombinant Human Collagen alpha-3(IV) chain(COL4A3),partial
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Purification Greater than 90% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:1427-1668aa
    Sequence Info:Partial
  • Alternative Names Goodpasture antigen
  • Accession No. Q01955
  • Calculated MW 28.5 kDa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence FVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMK
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant Human Collagen alpha-3(IV) chain(COL4A3),partial - SAB | Signalway Antibody


Background

Type IV collagen is the major structural component of glomerular basent mbranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin,nidogen.Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity; these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms.

Regerences

Novel COL4A5, COL4A4, and COL4A3 mutations in Alport syndrome.Nagel M., Nagorka S., Gross O.Hum. Mutat. 26:60-60(2005)
Research Topic:Cell Adhesion

    Please let us know if you have published research using #AP70182 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com