Your Position: Home > Recombinant Proteins > Recombinant mouse Cathepsin K

Recombinant mouse Cathepsin K

AP70209
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP70209-1 10ug $194.00
AP70209-2 50ug $276.00
AP70209-3 100ug $478.00
AP70209-4 200ug $786.00
AP70209-5 500ug $1321.00
AP70209-6 1mg $2103.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant mouse Cathepsin K
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Purification Greater than 90% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:115-329aa
    Sequence Info:Full Length
  • Accession No. P55097
  • Calculated MW 27.4 kDa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant mouse Cathepsin K - SAB | Signalway Antibody


Background
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation .
Regerences
Complete genomic structure of the mouse cathepsin K gene (Ctsk) and its localization next to the Arnt gene on mouse chromosome 3.Rantakokko J.A., Kiviranta R., Eerola R., Aro H.T., Vuorio E.Matrix Biol. 18:155-161(1999)
Research Topic:Others
    Please let us know if you have published research using #AP70209 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com