- Product NameRecombinant Escherichia coli Beta-lactamase CTX-M-1
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:29-291aa
Sequence Info:Full Length - Alternative Names Beta-lactamase MEN-1Cefotaximase 1
- Accession No. P28585
- UniprotP28585
- Gene ID13909205;18157735;18157940;18253700;20467196;20468446;20468667;20468704;20491285;20491588;20491644;20491828;20492024;20492148;20492968;32464425;39692553;
- Calculated MW 32.2 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.