Your Position: Home > Recombinant Proteins > Recombinant Human Erythropoietin protein(EPO)

Recombinant Human Erythropoietin protein(EPO)

AP73384
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP73384-1 500IU $88.00
AP73384-2 2000IU $217.00
AP73384-3 15000IU $514.00
AP73384-4 37500IU $786.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant Human Erythropoietin protein(EPO)
  • Brief Description Recombinant Protein
  • Host Species Mammalian cell
  • Purification >98% as determined by SDS-PAGE and HPLC.
  • Biological Activity Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and was found to be no less than 1.5 105 IU,mg.
  • Immunogen Description Expression Region:28-193aa
    Sequence Info:Full Length of Mature Protein
  • Alternative Names Epoetin,
  • Accession No. P01588
  • Calculated MW 21.0 kDa
  • Tag Info NO-tagged
  • Target Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
  • Formulation 0.2μm filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid) ,lyophilized
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant Human Erythropoietin protein(EPO) - SAB | Signalway Antibody


Background
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Regerences
PubMed ID: 3838366; 3865178; 9799793; 12853948; 15489334; 8396923; 3949763; 6698989; 3346214; 3219367; 1820196; 11739166; 9774108; 9783743; 18458324
Research Topic:Cancer
    Please let us know if you have published research using #AP73384 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com