Your Position: Home > Recombinant Proteins > Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial

Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial

AP73667
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP73667-1 10ug $105.00
AP73667-2 50ug $260.00
AP73667-3 100ug $454.00
AP73667-4 200ug $735.00
AP73667-5 500ug $1240.00
AP73667-6 1mg $1980.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Target Name AGA
  • Alternative Names Aspartylglucosaminidase;Glycosylasparaginase;N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase
  • Accession No. Uniprot ID: P20933
  • Target Species Hu
  • SDS-PAGE MW 31.1kDa
  • Target Length Partial,206-346aa
  • Tag Info N-terminal 6xHis-SUMO-tagged
  • Target Sequence TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.
Application Details

Greater than 90% as determined by SDS-PAGE.

Images
  • Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial - SAB | Signalway Antibody


Background
Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
Regerences
Cloning and sequence analysis of a cDNA for human glycosylasparaginase. A single gene encodes the subunits of this lysosomal amidase.Fisher K.J., Tollersrud O.-K., Aronson N.N. Jr.FEBS Lett. 269:440-444(1990)
    Please let us know if you have published research using #AP73667 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2017 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com