Your Position: Home > Recombinant Proteins > Recombinant Human Histone deacetylase 6 HDAC6

Recombinant Human Histone deacetylase 6 HDAC6

AP74156
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP74156-1 10ug $130.00
AP74156-2 50ug $186.00
AP74156-3 100ug $323.00
AP74156-4 200ug $532.00
AP74156-5 500ug $895.00
AP74156-6 1mg $1428.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant Human Histone deacetylase 6 HDAC6
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Purification Greater than 90% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:1-488aa
    Sequence Info:Partial
  • Accession No. Q9UBN7
  • Calculated MW 70.1 kDa
  • Tag Info N-terminal 6xHis-SUMO-tagged
  • Target Sequence MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant Human Histone deacetylase 6 HDAC6 - SAB | Signalway Antibody


Background
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.By similarity3 Publications In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Regerences
"Three proteins define a class of human histone deacetylases related to yeast Hda1p."Grozinger C.M., Hassig C.A., Schreiber S.L.Proc. Natl. Acad. Sci. U.S.A. 96:4868-4873(1999)
Research Topic:Epigenetics and Nuclear Signaling
    Please let us know if you have published research using #AP74156 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com