Your Position: Home > Recombinant Proteins > Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

AP89528
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP89528-1 100uh $694.00
AP89528-2 1mg $2083.00

Availability: promotion

add promotion
Description
  • Product Name Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial
  • Brief Description Recombinant Protein
  • Purification Greater than 85% as determined by SDS-PAGE.
  • Alternative Names Spike glycoprotein
  • Accession No. Uniprot ID: MN908947
  • Calculated MW 78.0kDa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
  • Storage Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Application Details

 Expression Region: 16-685aa

 Sequence Info: partial(Spike protein S1 chain)

 Research Topic: Microbiology 

 Organism: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) 

 Storage Buffer: 

Product Description

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

    Please let us know if you have published research using #AP89528 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2019 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com