Your Position: Home > Recombinant Proteins > Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial

AP70634
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP70634-1 10ug $245.00
AP70634-2 50ug $348.00
AP70634-3 100ug $601.00
AP70634-4 200ug $991.00
AP70634-5 500ug $1321.00
AP70634-6 1mg $2103.00

Quantity:  Total:   
 

Availability: promotion15-25 business day

add promotion
Description
  • Product Name Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Purification Greater than 90% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:400-599aa
    Sequence Info:Partial
  • Accession No. P81265
  • Calculated MW 26.1 kDa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence ESRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial - SAB | Signalway Antibody


Background

This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.

Regerences

Cloning and characterization of two forms of bovine polymeric immunoglobulin receptor cDNA.Kulseth M.A., Krajci P., Myklebost O., Rogne S.DNA Cell Biol. 14:251-256(1995)
Research Topic:Others

    Please let us know if you have published research using #AP70634 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2019 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com