Home
Antibodies
Proteins
IVD Raw Materials
Assay Kits
ELISA Kits
KD/KO Validation
About Us

Recombinant human Histone H2B type 1-C/E/F/G/I #AP71735

Review:
Datasheet PDF
add to favorites
Catalog No. Package Size Price Quantity
20ug $242.00
100ug $456.00
1mg $1978.00
Availability:15-25 business day
Total:
ADD TO CART
 
Datasheet Images Protocol
Description
  • Product NameRecombinant human Histone H2B type 1-C/E/F/G/I
  • Brief DescriptionRecombinant Protein
  • Host SpeciesE.coli
  • PurificationGreater than 90% as determined by SDS-PAGE.
  • Immunogen DescriptionExpression Region:2-125aa
    Sequence Info:Full Length
  • Alternative Names    Histone H2B.1 AHistone H2B.a ;H2B,aHistone H2B.g ;H2B,gHistone H2B.h ;H2B,hHistone H2B.k ;H2B,kHistone H2B.l ;H2B,l
  • Uniprot P62807
  • Gene ID 3017;8339;8343;8344;8346;8347;
  • Accession No. P62807
  • Calculated MW 40.6 kDa
  • Tag Info N-terminal GST-tagged
  • Target Sequence PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Background
Regerences

Published Papers

Please let us know if you have published research using #AP71735 so that we can cite your reference.

Customer Reviews and Rankings

No comment
Total 0 results, divided into1 pages. First Prev Next Last

My Review

Username:Anonymous user
E-mail:
Ratings:
Content:
Verification code:captcha

Application

WBWestern Blotting

IHCImmunohistochemistry

IFImmunofluorescence

ICCImmunocytochemistry

FCFlow Cytometry

IPImmunoprecipitation

EELISA

DBDot Blotting

ChIPChromatin Immunoprecipitation

GICAGold Immunochromatography Assay

NCNegative Control

Species Reactivity

HuHuman

MsMouse 

RtRat 

Dm Drosophila melanogaster

C Caenorhabditis elegans

MkMonkey

RbRabbit

B Bovine 

D Dog

PPig

HmHamster

ChHm Chinese Hamster 

ChkChicken  

ShpSheep