Your Position: Home > Recombinant Proteins > Recombinant human RING-box protein 2

Recombinant human RING-box protein 2

AP70720
Review: comment rank 5 pdf
  Catalog No. Package Size Price
AP70720-1 10ug $130.00
AP70720-2 50ug $186.00
AP70720-3 100ug $323.00
AP70720-4 200ug $532.00
AP70720-5 500ug $895.00
AP70720-6 1mg $1428.00

Quantity:  Total:   
 

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant human RING-box protein 2
  • Brief Description Recombinant Protein
  • Host Species E.coli
  • Purification Greater than 90% as determined by SDS-PAGE.
  • Immunogen Description Expression Region:2-113aa
    Sequence Info:Full Length
  • Alternative Names CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein
  • Accession No. Q9UBF6
  • Calculated MW 39.6 kDa
  • Tag Info N-terminal GST-tagged
  • Target Sequence ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Images
  • Recombinant human RING-box protein 2 - SAB | Signalway Antibody


Background
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Regerences
Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748(1999)
Research Topic:Epigenetics and Nuclear Signaling
    Please let us know if you have published research using #AP70720 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  
      SUBSCRIBE OUR E-MAIL
    • Inspiration, ideas and your feedback.
    FOLLOW US

    facebook twitter linkedin

    sab © 2018 Signalway Antibody LLC. All Rights Reserved.  E-mail: info@signalwayantibody.com