• Product NameRecombinant Human Histone H1.0(H1F0)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationAffinity purified using IMAC
• Immunogen DescriptionExpression Region:1-194aa
  Sequence Info:Full Length
• Alternative Names    Histone H1' Histone H1(0)
• Accession No. P07305
• UniprotP07305
• Gene ID3005;
• Calculated MW Predicted band size: 52.4 kDa
• Tag Info N-terminal 6xHis-GST-tagged
• Target Sequence MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
• Formulation Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
• Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C
  Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.

"Evidence for insertional RNA editing in humans." Zougman A., Ziolkowski P., Mann M., Wisniewski J.R. Curr. Biol. 18:1760-1765(2008)

• (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  Observed band size: 60kDa The reducing (R) protein migrates as 60 kDa in SDS-PAGE may be due to molecular structure of protein.

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting