• Product NameRecombinant Human Sodium,glucose cotransporter 2(SLC5A2),partial
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-102aa
  Sequence Info:Partial
• Alternative Names    Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
• Accession No. P31639
• UniprotP31639
• Gene ID6524;
• Calculated MW 15.5 kDa
• Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Target Sequence MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+,glucose cotransporter arranged in series along kidney proximal tubules

"Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes." Castaneda F., Burse A., Boland W., Kinne R.K. Int J Med Sci 4:131-139(2007)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting