- Product NameRecombinant Human Pulmonary surfactant-associated protein A1(SFTPA1)
- Brief DescriptionRecombinant Protein
- Host Speciesin vitro E.coli expression system
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:21-248aa
Sequence Info:Full Length - Alternative Names Collectin-4
- Accession No. Q8IWL2
- UniprotQ8IWL2
- Gene ID653509;
- Calculated MW 41.2 kDa
- Tag Info N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
- Target Sequence EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.