Home
Antibodies
Covid-19 Test Kits
Diagnostic Kits
Proteins
ELISA Kits
Assay Kits
About Us

Recombinant Cryptomeria japonica (Japanese cedar) (Cupressus japonica) Sugi basic protein #AP71012

Review:
Datasheet PDF
add to favorites
Catalog No. Package Size Price Quantity
20ug $404.00
100ug $758.00
1mg $2569.00
Availability:15-25 business day
Total:
ADD TO CART
 
Datasheet Images Protocol
Description
  • Product NameRecombinant Cryptomeria japonica (Japanese cedar) (Cupressus japonica) Sugi basic protein
  • Brief DescriptionRecombinant Protein
  • Host SpeciesE.coli
  • PurificationGreater than 90% as determined by SDS-PAGE.
  • Immunogen DescriptionExpression Region:22-374aa
    Sequence Info:Full Length
  • Accession No. P18632
  • Calculated MW 54.5 kDa
  • Tag Info N-terminal 6xHis-SUMO-tagged
  • Target Sequence DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC
  • Formulation Tris-based buffer50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
    Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Background
Regerences

Published Papers

Please let us know if you have published research using #AP71012 so that we can cite your reference.

Customer Reviews and Rankings

No comment
Total 0 results, divided into1 pages. First Prev Next Last

My Review

Username:Anonymous user
E-mail:
Ratings:
Content:
Verification code:captcha

Application

WBWestern Blotting

IHCImmunohistochemistry

IFImmunofluorescence

ICCImmunocytochemistry

FCFlow Cytometry

IPImmunoprecipitation

EELISA

DBDot Blotting

ChIPChromatin Immunoprecipitation

GICAGold Immunochromatography Assay

NCNegative Control

Species Reactivity

HuHuman

MsMouse 

RtRat 

Dm Drosophila melanogaster

C Caenorhabditis elegans

MkMonkey

RbRabbit

B Bovine 

D Dog

PPig

HmHamster

ChHm Chinese Hamster 

ChkChicken  

ShpSheep