- Product NameRecombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:20-89aa
Sequence Info:Full Length of Mature Protein - Alternative Names Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B
- Accession No. P09386
- UniprotP09386
- Gene ID1262010;
- Calculated MW 23.8 kDa
- Tag Info N-terminal 6xHis-SUMO-tagged
- Target Sequence ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.