- Product NameRecombinant Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic(BAS1)
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:66-266aa
Sequence Info:Full Length of Mature Protein - Alternative Names Thiol-specific antioxidant protein A
- Accession No. Q96291
- UniprotQ96291
- Gene ID820335;
- Calculated MW 27.4 kDa
- Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Target Sequence KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.