• Product NameRecombinant Bovine Gap junction delta-2 protein(GJD2)
• Brief DescriptionRecombinant Bovine Gap junction delta-2 protein(GJD2)
• Host Speciesin vitro E.coli expression system
• Target NameGJD2
• Alternative Names    GJD2; GJA9Gap junction delta-2 protein; Connexin-36; Cx36; Gap junction alpha-9 protein
• Accession No. Swiss_Prot:Q866T7
• UniprotQ866T7
• Target Species Bos taurus (Bovine)
• Target Length Full length, 1-321aa
• Tag Info N-terminal 10xHis-tagged
• Target Sequence MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP PESMGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSG LRTASRSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECDRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV
• Formulation Tris-based buffer,50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20��/-80��. The shelf life of lyophilized form is 12 months at -20��/-80��.

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.Interneuronal communication at gap junctions made by connexin 36 may not be regulated by direct phosphorylation of connexin 36, but possibly by phosphorylation of associated proteins. PMID: 14658767

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting