Home
Antibodies
Proteins
IVD Raw Materials
Assay Kits
ELISA Kits
KD/KO Validation
About Us

Recombinant Human NACHT, LRR and PYD domains-containing protein 3(NLRP3),partial #AP89639

Review:
Datasheet PDF
add to favorites
Catalog No. Package Size Price Quantity
20ug $499.00
100ug $699.00
1mg $2499.00
Availability:15-35 business day
 
Datasheet Images Protocol
Description
  • Product NameRecombinant Human NACHT, LRR and PYD domains-containing protein 3(NLRP3),partial
  • Brief DescriptionRecombinant Protein
  • Host SpeciesE.coli
  • PurificationGreater than 85% as determined by SDS-PAGE.
  • Immunogen DescriptionExpression Region: 733-1036aa Sequence Info:partial
  • Target NameNLRP3
  • Alternative Names    (Angiotensin/vasopressin receptor AII/AVP-like)(Caterpiller protein 1.1)(CLR1.1)(Cold-induced autoinflammatory syndrome 1 protein)(Cryopyrin)(PYRIN-containing APAF1-like protein 1)
  • Accession No. Q96P20
  • Target Species Homo sapiens (Human)
  • Calculated MW 40.7 kDa
  • Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Target Sequence LFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Published Papers

Please let us know if you have published research using #AP89639 so that we can cite your reference.

Customer Reviews and Rankings

No comment
Total 0 results, divided into1 pages. First Prev Next Last

My Review

Username:Anonymous user
E-mail:
Ratings:
Content:
Verification code:captcha

Application

WBWestern Blotting

IHCImmunohistochemistry

IFImmunofluorescence

ICCImmunocytochemistry

FCFlow Cytometry

IPImmunoprecipitation

EELISA

DBDot Blotting

ChIPChromatin Immunoprecipitation

GICAGold Immunochromatography Assay

NCNegative Control

Species Reactivity

HuHuman

MsMouse 

RtRat 

Dm Drosophila melanogaster

C Caenorhabditis elegans

MkMonkey

RbRabbit

B Bovine 

D Dog

PPig

HmHamster

ChHm Chinese Hamster 

ChkChicken  

ShpSheep