- Product NameRecombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial
- Brief DescriptionRecombinant Proteins
- Host SpeciesYeast
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionPartial Expression Region: 56-219aa
- Target NameHis-tagged
- Alternative Names (RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)
- Accession No. Q9ULT6
- Target Species Homo sapiens (Human)
- SDS-PAGE MW 19.7 kDa
- Tag Info C-terminal 6xHis-tagged
- Target Sequence KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
